SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015505 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015505
Domain Number 1 Region: 56-316,415-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.51e-79
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000328
Further Details:      
 
Domain Number 2 Region: 506-667
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 1.57e-42
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00027
Further Details:      
 
Domain Number 3 Region: 293-411
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 8.52e-42
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000623
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015505   Gene: ENSMLUG00000017004   Transcript: ENSMLUT00000017009
Sequence length 667
Comment pep:putative scaffold:Myoluc2.0:GL429767:48912789:48941175:1 gene:ENSMLUG00000017004 transcript:ENSMLUT00000017009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGLRVASKLLRPRRLGLTGTKMFDGSLKKKRSRGFDFTVDGSKRSSAKVSDSISTQYPV
VDHEFDAVVVGAGGAGLRAAFGLSEAGFSTACVTKLFPTRSHTVAAQGGINAALGNMEED
NWRWHFYDTVKGSDWLGDQDAIHYMTEQAPASVIELENYGMPFSRTKDGKIYQRAFGGQS
LKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIAL
CIEDGYIHRIRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHP
TGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGC
GPEKDHVYLQLHHLPPEQLAMRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNF
KGQVLRQVNGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRP
GDKVPPIKANAGEESVMNLDKLRFADGSIRTSELRLNMQKSMQNHAAVFRVGSVLQEGCE
KISQLYGELKHLKTFDRGMVWNTDLLETLELQNLMLCALQTIYGAEARKESRGAHAREDY
KDRVDEYDYSKPIQGQQKKPFEQHWRKHTLSYVDVGTGKVSLKYRPVIDKTLNESDCATV
PPAIRSY
Download sequence
Identical sequences G1PVW0
ENSMLUP00000015505 ENSMLUP00000015505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]