SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000015831 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000015831
Domain Number 1 Region: 113-399
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-77
Family Protein kinases, catalytic subunit 0.0000149
Further Details:      
 
Domain Number 2 Region: 48-129
Classification Level Classification E-value
Superfamily SH3-domain 1.05e-20
Family SH3-domain 0.00055
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000015831
Domain Number - Region: 418-486
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00612
Family Regulator of G-protein signaling, RGS 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000015831   Gene: ENSMLUG00000017361   Transcript: ENSMLUT00000017365
Sequence length 1078
Comment pep:putative scaffold:Myoluc2.0:GL429852:4468179:4538081:-1 gene:ENSMLUG00000017361 transcript:ENSMLUT00000017365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKISRAFFGCLASAAAAAPEDGAGAGAEEEEEEEEEAAAAPGELGSDAPLPYWTAVFEYE
AAGEDELTLRLGDVVEVLSKDSQVSGDEGWWTGQLNQRVGIFPSNYVTPRSAFSSRCQPG
GEDPSCYPPFQLLEIDFAELTLEEIIGIGGFGKVYRAFWIGDEVAVKAARHDPDEDISQT
IENVRQEAKLFAMLKHPNIIALRGVCLKEPNLCLVMEFARGGPLNRVLSGKRIPPDILVN
WAVQIARGMNYLHDEAIVPIIHRDLKSSNILILQKVENGDLSNKILKITDFGLAREWHRT
TKMSAAGTYAWMAPEVIRASMFSKGSDVWSYGVLLWELLTGEVPFRGIDGLAVAYGVAMN
KLALPIPSTCPEPFAKLMEDCWNPDPHSRPPFTNILDQLTTIEESGFFEMPKDSFHCLQD
DWKHEIQEMFDQLRAKEKELRTWEEELTRAALQQKNQEELLRRREQELAEREIDILGREL
NIIIHQLCQEKPRVKKRKGKFRKNRLKLKDGNRISLPSADFQHKFTVQASPTMDKRKSLS
SSRSSPPASPTIIPRLRAIQLTPGESSKTWGRSSVIPKEEGEEEEKRASKKKGRTWGPGT
LGQKELASGDEGLKSLVDGYKQWSSSAPNLGKGPRSSPALPGFTSLTEMEDEDSEGPGSG
ESRLQHSPNQSYLCIPFPRGEDGDGPPSDTAHEEPTPVNSATSTPQLTPTNSLKRGGAHH
RRCEVALLGCGAVLAATGLGFDLLEAGKCQLPLPEEPEPPAREEKKRREGLFQRASRPRR
STSPPSRKLFKKEEPMLLLGDPSASLTLLSLSSISECNSTRSLLRSDSDEIVVYEMPVSP
VEAPPPTPCTHNPLVNIRVERFKRDPHQSLTPTHVTLTAPTQPSGHRRTPSEGALKPAAL
LASRSPSSNGLSPSPGAGMLKTPSPSRDPGEFPRLPDPNVVFPPTPRRWNTQQDSTLERP
KTLEFLPRPRPSANRHRLDPWWFVSPSHARSASPANSSSTETPSNLDSCLASSSSTLEER
PGLPALLPFQAGPLPPTERTLLDLDAEGQSQDSTVPLCRAELSAHRPAPYEIQQEFWS
Download sequence
Identical sequences G1PWP4
ENSMLUP00000015831 ENSMLUP00000015831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]