SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Myotis lucifugus 69_2.0 > ENSMLUP00000016140

Domain assignment for ENSMLUP00000016140 from Myotis lucifugus 69_2.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSMLUP00000016140
Domain Number 1	Region: 26-238
Classification Level	Classification	E-value
Superfamily	Ankyrin repeat	2.07e-48
Family	Ankyrin repeat	0.00022
Further Details:

Domain Number 2	Region: 251-292
Classification Level	Classification	E-value
Superfamily	SOCS box-like	0.000000222
Family	SOCS box-like	0.004
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSMLUP00000016140 Gene: ENSMLUG00000017696 Transcript: ENSMLUT00000017700
Sequence length	294
Comment	pep:putative scaffold:Myoluc2.0:GL429816:4596920:4617413:1 gene:ENSMLUG00000017696 transcript:ENSMLUT00000017700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MDREPPSRIGSKPSDLGDFSATRFLSNPLMGGVESDWSPMHEAAINGRLLSLRRLISQGW GVNIITADCVSPLHEACLGGHPACASILLKHGAEVDGVTTDWHTPLFNACVSGSQECVNL LLQYGASPHPACDLASPIHEAAKRGHMGCIESIAAHGGNIDYHISHLGTPLYLACENKQI ACVKKLLESGVNVNRGRDLESPLHAVARASNEEMATLLLDFGADMQAKNAEGKRPFELVS PDDPLFQLFMQREEPPSLMQLCRLQIRKCFGIQQHHKINELLLPDELKNFLLHS
Download sequence
Identical sequences	G1PXH1 ENSMLUP00000016140 XP_006088650.1.53796 XP_014311212.1.53796 ENSMLUP00000016140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]