SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016210 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016210
Domain Number 1 Region: 817-926
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-25
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 2 Region: 327-446
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.53e-17
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 48-180
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.06e-17
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 289-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000073
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 179-326
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000502
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 677-813
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000306
Family Growth factor receptor domain 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000016210
Domain Number - Region: 631-680
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00565
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016210   Gene: ENSMLUG00000017768   Transcript: ENSMLUT00000017772
Sequence length 1004
Comment pep:putative scaffold:Myoluc2.0:GL429828:4728165:4794417:1 gene:ENSMLUG00000017768 transcript:ENSMLUT00000017772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAVGGSRNPGSSLALGPVELLCPLDHPCRHLLLPTPLPGKGTRAPSADVDECAQGLDDCH
TNALCQNTLTSYKCSCKPGYQGEGRQCEDIDECENELKGGCVHDCLNIPGNYRCTCFDGF
MLAHDGHNCLDVDECLENNGGCQHTCLNALGSYECRCKEGFFLSDNQHTCIHRSEEGLSC
MNKNHGCSHICKEAPKGSVACECRPGFELAKNQRDCILTCNHGNGGCQHSCEDTAEGPEC
SCHPQYKMHTDGRSCLEREDTALEVMENNATSVVDGDKRVKRRLLMETCAVNNGGCDRTC
KDTSTGVHCSCPVGFTLQLDGKTCKDIDECQTRNGGCDHFCKNTVGSFDCSCKKGFKLLT
DEKSCQDVDECSLDRTCDHSCINHPGTFTCACNKGYTLYGFTHCGDTNECSINNGGCQQV
CVNTVGSYECQCHSAYKLHWNKKDCVEVKGALPTSVSPHVSLHCGKSGGGDRCFLRCHSG
IHLSSEDVVTIRTSVTFKLNEGKCSLKKAELFPEGLRPAQPEKHSSVKESFRYAHLTCGF
RKRVPGAPGRPSATKEVFITVEFELETNQKEVTAACDLSCIVKRTEKRLRKAIRTLRKAA
HREQFHLQLSGMDLEVARKSPRASERRTEACGVGQSHVGNQCVSCRAGTYYDGSQERCIL
CPNGTFQNEEGQVTCEPCPRPDNPGTLKTPDAWNVSECGGLCQPGEYSADGFAPCQLCAL
GTFQPEAGRTSCFSCGGGLPTKHLGATSFQDCETRVQCSPGHFYNTTTHRCIRCPAGTYQ
PEFGKNNCVSCPGNTTTDFDGSTNITQCKNRRCGGELGDFTGYIESPNYPGNYPANTECT
WTINPPPKRRILIVVPEIFLPIEDDCGDYLVMRKTSSSNSVTTYETCQTYERPIAFTSRS
KKLWIQFKSNEGNSARGFQVPYVTYDAEDYQELIEDIVRDGRLYASENHQEILKDKKLIK
ALFDVLAHPQNYFKYTAQESREMFPKSFIRLLRSKVSRFLRPYK
Download sequence
Identical sequences G1PXN2
ENSMLUP00000016210 ENSMLUP00000016210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]