SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016269 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016269
Domain Number 1 Region: 16-121
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000066
Further Details:      
 
Domain Number 2 Region: 140-252
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-34
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016269   Gene: ENSMLUG00000028238   Transcript: ENSMLUT00000027942
Sequence length 535
Comment pep:putative scaffold:Myoluc2.0:GL431078:65982:72192:1 gene:ENSMLUG00000028238 transcript:ENSMLUT00000027942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVSLYHCLGFQNDSGLALRLVNGSDRCQGRVEVLYRGSWGTVCDDGWDTNDANVVCRQLG
CGWARAAPGSARFGQGSGPIVLDDVGCSGHESFLWNCPHRGWNSHNCGHHEDAGVICSAP
PARVVRPVLWVTSISSVPAAAGACGGFLSRPSGRFSSPSYPGSYPNNARCVWDIEVQNNH
RVTVVFRDVQLESNCNYDYIEVFDGPALSSPLIARVCHGSRDSFTSSSNFMSIRFVSDGS
VTRSGFQADYYSRPSNHSTKLLCLPDRMQANVSRSYLQSLGYSASDLVILHWQDVQQCQA
QVTASQVTFTIPYAGCGTTQQLDNDTITYSNTLQAAIPVGNGLIQRRPSLHLHVSCRMLR
DTWVDLMYVANDNAEVQEVQYGNFAVNMSFYTSSSFAYPVTMHPYYVRLNQDLYVQAEIR
RAAAPMALFVDTCVASPSSQDLPSVAYDLIRSGCVRDDTYQAPRPHPASPASSSRSFHFL
HRLPAVYLHCKVLVCRAHDPASRCRGGCQPRPKRDLGSYQEKVDVVLGPIRLQAP
Download sequence
Identical sequences G1PXT7
ENSMLUP00000016269 ENSMLUP00000016269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]