SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000016517 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000016517
Domain Number 1 Region: 42-189
Classification Level Classification E-value
Superfamily EF-hand 4.02e-33
Family Calmodulin-like 0.00000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000016517   Gene: ENSMLUG00000027789   Transcript: ENSMLUT00000023516
Sequence length 191
Comment pep:putative scaffold:Myoluc2.0:GL429866:1125980:1135623:-1 gene:ENSMLUG00000027789 transcript:ENSMLUT00000023516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKKPEPKKEAAKAAPAPAPAPAPEPPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRT
PTGEMKIAYAQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNAKMLDFETFLPILQHISRN
KEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCIN
YEAFVKHIMSG
Download sequence
Identical sequences G1PYI5
ENSMLUP00000016517 ENSMLUP00000016517 XP_006092244.1.53796 XP_006770332.1.95426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]