SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000017392 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000017392
Domain Number 1 Region: 1-38
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000899
Family Cadherin 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000017392   Gene: ENSMLUG00000024539   Transcript: ENSMLUT00000027882
Sequence length 38
Comment pep:putative scaffold:Myoluc2.0:GL432357:11297:11410:1 gene:ENSMLUG00000024539 transcript:ENSMLUT00000027882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YTKLSDPANWLRIDPVNGQITTIAVLDRESPHVKNNIY
Download sequence
Identical sequences G1Q109
ENSMLUP00000017392 ENSMLUP00000017392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]