SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018679 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018679
Domain Number 1 Region: 11-172
Classification Level Classification E-value
Superfamily alpha-ketoacid dehydrogenase kinase, N-terminal domain 3.66e-61
Family alpha-ketoacid dehydrogenase kinase, N-terminal domain 0.0000000422
Further Details:      
 
Domain Number 2 Region: 190-358
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.51e-26
Family alpha-ketoacid dehydrogenase kinase, C-terminal domain 0.0000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018679   Gene: ENSMLUG00000026890   Transcript: ENSMLUT00000025098
Sequence length 415
Comment pep:putative scaffold:Myoluc2.0:GL429779:9023005:9024522:1 gene:ENSMLUG00000026890 transcript:ENSMLUT00000025098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLFWWLLKQPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYRFLRKELPVRLANS
MREVNLLPDNLLTRPSVGLVQSWYVQSFLELLEYENKSPEDPKVLDNFLQVLIQVRNRHN
DVVPTMAQGVIEYKEKFGFDPFTSSNIQYFLDRFYTNRISFRMLINQHTLLFGGDTNPAH
PKHIGSIDPTCNVADVVKDAYETAKMLCEQYYMVAPELEVEEFNAKAPGKPIQVVYVPSH
LFHMLFELFKNSMRATIELYEDRKEAYPAIKTLVTLGKEDLSIKISDLGGGVPLRKIDHL
FNYMYSTAPRPSLEPSRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVINLKA
LSSESFERLPIFNKSAWRRYKTTPGANDWSNPSREPRDASKCKSPMHTVYNNRII
Download sequence
Identical sequences G1Q4P6
ENSMLUP00000018679 ENSMLUP00000018679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]