SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000018831 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000018831
Domain Number 1 Region: 249-292
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000981
Family SOCS box-like 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000018831
Domain Number - Region: 91-172
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000166
Family Ankyrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000018831   Gene: ENSMLUG00000025222   Transcript: ENSMLUT00000025093
Sequence length 295
Comment pep:putative scaffold:Myoluc2.0:GL429792:2520452:2534067:-1 gene:ENSMLUG00000025222 transcript:ENSMLUT00000025093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKSSKLCRKTSCPRSNIFCSLVDKIVKRPSLQFLGQWGYHCYEPRIYRTLAKILRYVDL
DGFDILLTDYIAFVEKSGYRFELNFNLEFTEICVNTILYWIFARKGNPDFVELLLKKTKD
YVQDRSCNLALIWRTFTPVYCPSPLSGITPLLYVAQTRQSSILKILLQYGILEREKNPIN
IVLTILLYPSRVRIMVDHELVDIQEDAKTCLVLCSRVLSVISIREIQTQLNLGRRPIISD
WFNYIPSTRYRDPCELLHLCRITIRSQLLTNNMLPNGIFSLPIPVRLQNYLNLES
Download sequence
Identical sequences G1Q548
ENSMLUP00000018831 XP_006086158.1.53796 ENSMLUP00000018831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]