SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019105 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019105
Domain Number 1 Region: 188-525
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-80
Family Protein kinases, catalytic subunit 0.00000231
Further Details:      
 
Domain Number 2 Region: 34-182
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.42e-36
Family Regulator of G-protein signaling, RGS 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019105   Gene: ENSMLUG00000028939   Transcript: ENSMLUT00000025200
Sequence length 562
Comment pep:putative scaffold:Myoluc2.0:GL430162:459813:474156:1 gene:ENSMLUG00000028939 transcript:ENSMLUT00000025200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGSLETVVANSAFIAARGSFDGSCAPPSRDKKYRAKLKLPPLSKCQALGDSLDLEFQSLC
SEQPIGKRLFQQFLKADERHVPALELWKDIEDYDTADDDLRPQKARAILAEYLDPQAKLF
CDFLDEGMAAKVREGPAASEDGLFQPLLQATLAHLSQAPFQEFLGSLYFQRFLQWKWLEA
QPTGEDWFLDFRVLGKGGFGEVSACQMKATGKMYACKKLNKKRLKKRKGYQGAMVEKKIL
AKVHSRFIVSLAYAFETKTDLCLVMTIMNGGDLRYHIYNVDEENPGFQQPRAVFYVAQIL
SGLEHLHQRGIVYRDLKPENVLLDDEGNIRISDLGLAVELKEGQTKTKGYAGTPGFMAPE
LLRGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKQRILSEAVKYTDKFSQA
SKDFCEALLEKDPEKRLGFRDGTCDGLRVNPLFKDINWRQLEAGMLIPPFIPDSRTVYAK
NIQDVGAFSTVKGVVFEKADTEFFQEFATGNCSIPWQEEMIETGIFGELNVWRADGQMPD
DMKGITVEEAAPSSKSGMCLVS
Download sequence
Identical sequences G1Q5X2
ENSMLUP00000019105 ENSMLUP00000019105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]