SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019147 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019147
Domain Number 1 Region: 67-162
Classification Level Classification E-value
Superfamily SH2 domain 2.42e-24
Family SH2 domain 0.0000532
Further Details:      
 
Domain Number 2 Region: 206-250
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000366
Family SOCS box-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019147   Gene: ENSMLUG00000024464   Transcript: ENSMLUT00000030840
Sequence length 251
Comment pep:putative scaffold:Myoluc2.0:GL431602:27108:30896:-1 gene:ENSMLUG00000024464 transcript:ENSMLUT00000030840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLCVQGPCPLLAPERIGQRPRWAQPEPVMQPLPAGPFPEEVAEEAPAQPESEPKVLDPE
EDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTR
GPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCATDTRSDSPDPAPTPAP
PVPKEAGDPALPAPAATAVHLKLVQPFVHRGRAPSLQHLCRLAIHRLVADVDCLPLPRRM
ADYLRQYPFQL
Download sequence
Identical sequences G1Q614
ENSMLUP00000019147 ENSMLUP00000019147 XP_006108293.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]