SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019415 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019415
Domain Number 1 Region: 71-143
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.86e-18
Family Complement control module/SCR domain 0.00036
Further Details:      
 
Domain Number 2 Region: 193-256
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000621
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 3 Region: 134-205
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000021
Family Complement control module/SCR domain 0.00073
Further Details:      
 
Domain Number 4 Region: 6-81
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000111
Family Complement control module/SCR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019415   Gene: ENSMLUG00000029792   Transcript: ENSMLUT00000025412
Sequence length 258
Comment pep:putative scaffold:Myoluc2.0:GL429912:3175974:3193694:1 gene:ENSMLUG00000029792 transcript:ENSMLUT00000025412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCPDACDEIPRYESMKAKGNPVPPVSPGFAVEYECRPGYRLIVPLVRPTTTVCLADGTWA
PPLQEACTRKSCPQLTEPLNGRVEGSFQFGSQANYSCNEGYNLVGTPVLHCQLAGDGNNV
AWSGDPPQCEKILCQPPKQIENGIFSNSHKDIFEYNEVVTYSCKPSTGPDEYSLVGESRL
ICTGPNKWSSNPPECKVVKCPYPSLPDGTIVSGFGKKYYYKAEVQFECNQGYSLEGSRKI
VCEANNAWVPEIPRCVKG
Download sequence
Identical sequences G1Q6T2
ENSMLUP00000019415 ENSMLUP00000019415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]