SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019548 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000019548
Domain Number - Region: 48-93
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.00458
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019548   Gene: ENSMLUG00000008521   Transcript: ENSMLUT00000008514
Sequence length 99
Comment pep:putative scaffold:Myoluc2.0:GL429769:32731235:32731705:1 gene:ENSMLUG00000008521 transcript:ENSMLUT00000008514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKPCKENEGKAKSPMPKREECPYGECERQQTEGNFRQRLLQSLEEFKEDIDYKHFNNEE
MTREGDEMERCLEEIRGLRKEFRALHSNHRHSFSSFDPI
Download sequence
Identical sequences G1Q765
ENSMLUP00000019548 ENSMLUP00000019548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]