SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000019631 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000019631
Domain Number 1 Region: 1-60
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.000000123
Family Pyk2-associated protein beta ARF-GAP domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000019631   Gene: ENSMLUG00000015502   Transcript: ENSMLUT00000029308
Sequence length 516
Comment pep:putative scaffold:Myoluc2.0:GL429770:24410708:24465054:1 gene:ENSMLUG00000015502 transcript:ENSMLUT00000029308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYEKKRWYVP
PEQAKVVASVHASISGSSASSTSSTPEVKPLKSLLGDSAAALHLNKGTPSQSPVVGRSQG
QQQEKKFDLLSDLGSDIFAAPASQSSATANFANFAHFNSHAAQNSANADFANFDAFGQSS
GSSNFGGFPTASHSPFQPQTTAFRMLSSSCSFGEFTSAFPLQATNRGSAGSVNANFAHFD
NFPKSSSADFGTFSTSQSHQTATTVSKVATNKAGLQAADKYAALANLDNIFSAGQGGDQG
SGFGTAGKAPVSSVVSLPSQSSASSDKYAALAELDSVFSSAATSNNAYTSTSNASSNVFG
TMPVGASAQTQPASSSVPAPFGATPSTNPFVAAAGPSVASSTNPFQTNARGTTAATFGTA
SMSMPAGFGTPAPYSLPTSFSGSFQQPAFPAQAAFPQQTAFSQQPNGAGFAAFGQTKPMV
TPFGQVAAAGVSSNPFMTGAPTGQFPTGSSSTNPFL
Download sequence
Identical sequences G1Q7E8
ENSMLUP00000019631 ENSMLUP00000019631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]