SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020121 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020121
Domain Number 1 Region: 11-115
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.09e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020121   Gene: ENSMLUG00000017637   Transcript: ENSMLUT00000025373
Sequence length 523
Comment pep:putative scaffold:Myoluc2.0:GL429864:3095114:3104329:1 gene:ENSMLUG00000017637 transcript:ENSMLUT00000025373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEPSKTEIQTLFKRLRAIPTNKACFDCGAKNPSWASITYGVFLCIDCSGVHRSLGVHL
SFIRSTELDSNWSWFQLRCMQVGGNANATAFFRQHGCTASDANTKYDSRAARMYREKIRQ
LGSAALARHGTDLWIDNMSGAPSHSPERKDSDFFMEHTQPPWAEVPPLPLPGMYQPPTPP
RLQKAVDWHSRSMAPTRTCLAPHPNLWAEMKTSLIGKKKPAATKKGLGAKKGLGAQKVSS
QSFSEIERQAQVAEKLREQQVADAKKQAEESVVASMRLAYQELQIDRKKEEKQLQNLEGK
KREQAERLGMGLVSRSSVSHSVLSEMQVIEQETPVSAKSSRSQLDLFDDVGTFASGPPKY
KDNPFSLGESFASRWDTDATWGMDKMEEKEPEVTISSIRPISERVTNRKEVESRSSGLES
SEARQKFAGAKAISSDMFFGREVDTEYEARSRLQQLSGSSAISSSDLFGDVDGAHGTGNV
SLGNVLPTADIAQFKQGVKSVAGKMAVLANGVMNSLQDRYGSY
Download sequence
Identical sequences G1Q8T8
ENSMLUP00000020121 ENSMLUP00000020121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]