SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020485 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020485
Domain Number 1 Region: 53-183
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000523
Family Spermadhesin, CUB domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020485   Gene: ENSMLUG00000025557   Transcript: ENSMLUT00000025258
Sequence length 325
Comment pep:putative scaffold:Myoluc2.0:GL429767:37786507:37796401:-1 gene:ENSMLUG00000025557 transcript:ENSMLUT00000025258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPSFKLRCRFILIFLVALRGESRYLELREAGDQDPFLLLSAHLKRELAGEPLYRRALRC
LDMLSLQGQFTFTADRPQLHCAAFFISEPEEFITIYYDLVSIDCQGGDFLKVFDGWILKG
EKFPSSQDHPLPTTERYIDFCESGLGRRSIRSSQNVAMIFFRVHEPGNGFTLTIRTVPNL
FPCNVISQTPNGRFTLVVPHQHRNCSFSIIYPVMIKISDLTLGHLNGLQLKKPAAGCGGK
GDFVELLGGSGLDPSKMMPLADLCYPFQGPGMTAQMKIGCDNTVVRMVSSGKHINRVTFE
YRQLEPYELENPNGNSIREFCLSGL
Download sequence
Identical sequences G1Q9V2
ENSMLUP00000020485 ENSMLUP00000020485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]