SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000020549 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000020549
Domain Number 1 Region: 32-241
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.88e-32
Family Nuclear receptor ligand-binding domain 0.0000372
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000020549   Gene: ENSMLUG00000001676   Transcript: ENSMLUT00000001675
Sequence length 253
Comment pep:putative scaffold:Myoluc2.0:GL431085:5380:6959:-1 gene:ENSMLUG00000001676 transcript:ENSMLUT00000001675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPVQHLLPGPAQCLRPADEGAMVAGGDLFPGQPVSELIAQLLRAEPYPPGRFGGGGGSA
GAVLGIDKVCELAARLLLSAVEWRHAPFFPDLPVADQLSELFVLKATQAALLPAAAGLHA
ALMAADRAVAFMDPVRAFQEQVDKLGRLQVDSAEYGCLQAMALFTPDACGLDPAHVGSLQ
EKAQVALTEYRAQFPSQPQRFRHLLLAPALRAVPASLTSQLFFMRLVGKTPMEMLIRDML
LSGSTFHRPYGSG
Download sequence
Identical sequences G1QA16
ENSMLUP00000020549 ENSMLUP00000020549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]