SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021005 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000021005
Domain Number - Region: 130-136,198-214
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0785
Family Formin homology 2 domain (FH2 domain) 0.06
Further Details:      
 
Domain Number - Region: 238-285
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.0942
Family Delta-sleep-inducing peptide immunoreactive peptide 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021005   Gene: ENSMLUG00000028696   Transcript: ENSMLUT00000024505
Sequence length 313
Comment pep:putative scaffold:Myoluc2.0:GL429783:3361928:3393166:1 gene:ENSMLUG00000028696 transcript:ENSMLUT00000024505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLFSQPHYRGLLSPGTSCSYPSEDSSEDEEDEEEEQEVDVESHKPPEGEEEEEEGRDPDD
DEEEDEETGVLLGDPLVGGGRFLQGRGLSEKGSSRDRAPAAAGAFPLTLNSSRLLPEDGK
LGDPGGSDLPPPPPPPLASQKASGGGGDSSSSPGSPVHHPSLEEQPSYKDNQKTKENNQV
ILSTKDDNFSDKNKEHSFFITDSEASGGDFWRERSGEHTQETNSPHSLKKDVENMGKEEL
QKVLFEQIDLRRRLEQEFQVLKGNTSFPVFNNFQDQMKRELAYREEMVQQLQIIPYAASL
IRKEKLGAHLSKS
Download sequence
Identical sequences G1QBC2
ENSMLUP00000021005 ENSMLUP00000021005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]