SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021398 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021398
Domain Number 1 Region: 9-95
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000104
Family Protein kinases, catalytic subunit 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000021398
Domain Number - Region: 88-160
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.033
Family Regulator of G-protein signaling, RGS 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021398   Gene: ENSMLUG00000023950   Transcript: ENSMLUT00000029312
Sequence length 729
Comment pep:putative scaffold:Myoluc2.0:GL432552:1127:14473:-1 gene:ENSMLUG00000023950 transcript:ENSMLUT00000029312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSLAFQLRMLLWELLTGEVPYRGIDGLAVAYGVAVNKLTLPIPSTCPEPFASSFVECWQQ
DPHIRPSFALILEQLTAIEGAVMTEMPQESFHSMQDDWKLEIQQMFDELRTKEKELRSRE
EELNRAALQQKSQEELLKRREQQLAEREIDVLERELNILIYQLNQEKPKVKRRKGKFMRS
RLKLKDGHRISLPSDFQHKITVQASPNLDKRRSLNSSGSSPPSSPTVIPRLRAIQLTSDE
SNRTWGRSTVCRQEEFEDVRRNFKRRGCTWGPSSIQMKERTDCKERIRPLSDGNSPWSTL
FIKHHKTMPLDSLFVDQPGACEEPKPSADGSEPRKPQQIKPSAPAPADPPLGKDGQRESP
PETENWEDAASAAGTPQGTPTHTLSRPPPRRRTEGALYSCTALLAAVALGLDIRELPRVP
ASEEPGPREERKKREGILQRAPWPRGAADRPRASATLPPPGALGLLSRPSLSTKCLLQAE
GGDSLEGGAHSMRAPDVLTPGVCPAAGGCQPASPPRREAESGVWRHLGPPSSELPRGNAP
PCASSKKRAASHRRTVSDGNASLAPGLVSCRICIVSDVPVSDGTVFAFSAAAATGAPGLP
PERVWGPPHPSWPHRNLPLQALPLEAPRGKHRAFTPVPPPSALPAPTDAPQAFPGRTEPL
PAQTDPGLGGGALTPGCPLGARDRTRSLGPSLLDADVQGQSQDCTPPLCRAKSGNGRPAG
YQLEKEFLS
Download sequence
Identical sequences G1QCG5
ENSMLUP00000021398 ENSMLUP00000021398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]