SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000021902 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000021902
Domain Number 1 Region: 175-289
Classification Level Classification E-value
Superfamily Acid proteases 1.5e-27
Family Retroviral protease (retropepsin) 0.018
Further Details:      
 
Domain Number 2 Region: 2-38
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00001
Family Ubiquitin-related 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000021902   Gene: ENSMLUG00000030669   Transcript: ENSMLUT00000022243
Sequence length 354
Comment pep:putative scaffold:Myoluc2.0:GL430371:108596:128813:1 gene:ENSMLUG00000030669 transcript:ENSMLUT00000022243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVHAERPLTDNHRSLASYGLKDGDVVILRQKENVDPRPSQFPNLPRIDFRSISVPGTSSS
RQRQPPGAQQSHSSPGELALSPQGLDNPALLRDMLLANPHELSLLKERNPPLADALLSGD
LEKFTRVLVEQQQDRARREQERIRLFSADPFDLEAQAKIEEDIRQQNIEENMTIAMEEAP
ESFGQVVMLYINCKVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGT
QKIIGRVHLAQVQIEGDFLACSFSILEEQPMDMLLGLDMLKRHQCSIDLKKNVLVIGTTG
SQTTFLPEAELPECARLAYGAGREEVLRPEEIADRELAEALQKSVQDAGICSAG
Download sequence
Identical sequences G1PXR5
ENSMLUP00000016247 ENSMLUP00000021902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]