SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022355 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022355
Domain Number 1 Region: 11-55
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000258
Family EGF-type module 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022355   Gene: ENSMLUG00000022907   Transcript: ENSMLUT00000028338
Sequence length 88
Comment pep:putative scaffold:Myoluc2.0:GL429903:452878:458642:1 gene:ENSMLUG00000022907 transcript:ENSMLUT00000028338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATTTQSTWNDYFSPCPKKYEHYCINGKCRFVGALQTPSCLCDDVYTGVRCERVDCFYLRG
DTGQILVICLIAVMVPLIILVIGVCTCC
Download sequence
Identical sequences G1QF72
ENSMLUP00000022355 ENSMLUP00000022355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]