SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022656 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022656
Domain Number 1 Region: 42-211
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000223
Family HspBP1 domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022656   Gene: ENSMLUG00000029165   Transcript: ENSMLUT00000029797
Sequence length 258
Comment pep:putative scaffold:Myoluc2.0:GL430806:89399:91302:-1 gene:ENSMLUG00000029165 transcript:ENSMLUT00000029797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQSPRPRIGLHGFRVPGGRGRGPSGGAGGYNARAPLHYLGPVLSNLSQRPAARAFLLDRD
RCVVQRLLPLTQYPDSTVRRGGVVGTLRNCCFEHRHHEWLLGPEVDILPFLLLPLAGPED
FSEEEMERLPVDLQYLPPDKQREPDADIRKMLIEAIMLLTATAPGRQQVRDQGAYLILRE
LHNWEPESDVRGTCEKLIQVLIGDEPERGMENLLEVQVPEDVERQLQELDRQEQEQCLRE
QQERELSPEPQAEGAAPT
Download sequence
Identical sequences G1QG23
ENSMLUP00000022656 ENSMLUP00000022656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]