SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022679 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022679
Domain Number 1 Region: 6-252
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-81
Family Nuclear receptor ligand-binding domain 0.00000000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022679   Gene: ENSMLUG00000025626   Transcript: ENSMLUT00000022684
Sequence length 258
Comment pep:putative scaffold:Myoluc2.0:AAPE02065908:23:6628:1 gene:ENSMLUG00000025626 transcript:ENSMLUT00000022684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVQEERQRSRERAESEAECVGGAHEGMPVERILEAELAVDSNTESYGDMSMESSTNDPVT
NICHAADKQLFTLVEWAKRIPHFSGLTLEDQVILLRAGWNELLIASFSHRSVSVQDGILL
ATGLHVHRSSAHSAGVGSIFDRNRVLTELVSKMKDMQMDKSELGCLRAIVLFNPDAKGLS
NPSEVETLREKVYATLEAYTKQKYPDQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGD
TPIDTFLMEMLETPLQVT
Download sequence
Identical sequences G1QG46
ENSMLUP00000022679 ENSMLUP00000022679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]