SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000022786 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000022786
Domain Number 1 Region: 17-130
Classification Level Classification E-value
Superfamily Kringle-like 7.49e-28
Family Kringle modules 0.00091
Further Details:      
 
Domain Number 2 Region: 236-327
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000055
Family Spermadhesin, CUB domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000022786   Gene: ENSMLUG00000028516   Transcript: ENSMLUT00000027550
Sequence length 471
Comment pep:putative scaffold:Myoluc2.0:GL429839:5022700:5026361:-1 gene:ENSMLUG00000028516 transcript:ENSMLUT00000027550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTGAPQTLLLLLLPMLSPRGASAGSLHTPGLSECFQVNGADYRGRQNRTGPRGTGRPCL
FWDQTQQHSYSSARDPQGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPTCHM
PGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQWRGVEAGYACFCGSESDLA
RGRPAPATDCDQICFGHPGQLCGGDGRLGVYEGENGAKRGQENRAAAQAVILLPRTFPDE
MGTDQNCSWALGPPGAALELTFRLFELANQRARLGAARRGLGAGCYVPSTAPARRPLGTL
HLRAAALLLTFRSDARGHAQGFALTYRGVQDASENPVLPKGSAQTPAVLPDGTNVSCSPR
LGAPEATMGARVFSTVMAISVLLLLLLLLLLLLSLLRLLRRRSCLLAPGKGPPPLRPSQG
SGRSWAVWYRRPGGVALPCPPGDSQAEGLASTYRPLSASSQSSLRSLISAL
Download sequence
Identical sequences G1QGF3
ENSMLUP00000022786 ENSMLUP00000022786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]