SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000009 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000009
Domain Number 1 Region: 228-374
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-38
Family Third domain of FERM 0.00062
Further Details:      
 
Domain Number 2 Region: 126-230
Classification Level Classification E-value
Superfamily Second domain of FERM 8.64e-35
Family Second domain of FERM 0.0000807
Further Details:      
 
Domain Number 3 Region: 40-123
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.51e-25
Family First domain of FERM 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000009   Gene: ENSMLUG00000000009   Transcript: ENSMLUT00000000009
Sequence length 732
Comment pep:putative scaffold:Myoluc2.0:GL430014:910733:1060160:-1 gene:ENSMLUG00000000009 transcript:ENSMLUT00000000009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRFFRRTLGRRSMRKHAEKERLREAQRAATHIPAAGDSKSIITCRVSLLDGTDVSVDLP
KKAKGQELFDQITYHLDLIESDYFGLRFMDSAQVAHWLDVTKSIKKQVKIGSPYCLHFRV
KFYSSEPNNLREELTRYLFVLQLRQDILSGKLECPFDTAVQLAAYNVQAELGDCDLAEHS
PELITEFRFMPIQTEEMELAIFEKWKEYRGQTPAQAETNYLNKAKWLEMYGVDMHVVKAR
DGNDYSLGLTPTGVLVFEGETKIGLFFWPKITRLDFKKTKLTLVVVEDDDQGKEQEHTFV
FRLDHPKACKHLWKCAVEHHAFFRLRGPVQKGSQRSGFIRLGSRFRYSGKTEYQTTKTNK
ARRSTSFERRPSKRYSRRTLQMQAGTAKPEELSVHSNVSTQNNGSQQAWGMRSTLLGTSS
IPSGPALVEIENLPRSPGTDQHDRKCLPPNIDLLDSPALLETTIDDVIGAPDTVETLQSP
DEINVAPRQTGLEEPEVEGKTLKDAPEKLKHLEIENGSLPSPRPNIDVNINNQEEVVKLT
EKCLNNAIESPGLNARRVPPDLKSNILKAQVEAVQKVTREDSLLSHKNASVQDAATNRAV
VNENNVPLPEDSLAPAHTAPTGNGSALKDATDEFDALLLSLTENLIDSTVTPQVSSTSII
TPRWIVPQSSVLSNGLAGNGPSLVGKEGHDSGDLISLISPPAPFLVDAVTSSAPAVSGEP
ILKQKCLLTTEL
Download sequence
Identical sequences G1NSB3
XP_006098866.1.53796 ENSMLUP00000000009 ENSMLUP00000000009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]