SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000449 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000449
Domain Number 1 Region: 558-680
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-30
Family Cadherin 0.0015
Further Details:      
 
Domain Number 2 Region: 461-562
Classification Level Classification E-value
Superfamily Cadherin-like 4.58e-30
Family Cadherin 0.00085
Further Details:      
 
Domain Number 3 Region: 237-361
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-28
Family Cadherin 0.0008
Further Details:      
 
Domain Number 4 Region: 133-241
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-21
Family Cadherin 0.0024
Further Details:      
 
Domain Number 5 Region: 666-772
Classification Level Classification E-value
Superfamily Cadherin-like 6.02e-19
Family Cadherin 0.0028
Further Details:      
 
Domain Number 6 Region: 348-458
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000628
Family Cadherin 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000449   Gene: ENSMLUG00000000495   Transcript: ENSMLUT00000000494
Sequence length 1018
Comment pep:putative scaffold:Myoluc2.0:GL429780:9783497:9844999:-1 gene:ENSMLUG00000000495 transcript:ENSMLUT00000000494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLLSGTYIFAVLLACVVFQSGAQEKNYSIREEMPENVLIGDLLKDLNLSLIRHKSLKIP
MKFKLVYKTGEVPLIRIEEGTGEIFTTGARIDREKLCTGILLDGRCFYEVEVAVLPDEIF
RLVKIRFLIEDINDNAPLFPATVINISIPENSAINSRFALPAAIDPDIGINGVQNYQLIK
GQNVFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQKSSTAILQISIA
DINDNHPVFTESEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFYFSNLVSNIAKRLF
HLNSSTGLITIKEPLDREESPNHKLLVLASDGGLMPARAMVLVNVTDINDNVPSIDIRYI
INPINGTVVLSENASLNTKIALITVTDKDADHNGRVTCFTDHDVPFRLRPVFSNQFLLET
AAFLDYESTKEYAIKLLAADAGKPPLNQSSMLLIKIKDENDNAPVFTQSFISTSVPENNS
PGSQLTKISATDADTGRNAEISYLLGDDAPSEFNLDQRTGILTAMKKLDREKQEKYYFTV
LAKDNGIPPLITNVTVLVTVLDQNDNSPIFTHNEYNFYVPENLSRHGTVGLITVTDPDYG
ENSAVTLSILDVNDDFTIDSQTGVIRPNISFDREKQESYTFYVQAEDGGRVSRSSTAKVT
INVVDVNDNKPVFLVPSSNYSYELVLPSTDPGTVVFTVVAIDNDTGMNAELQYSIVGGNT
RGLFIINQTTGNITMKEKCVLADLGLHRLVVKANDLGQPDSLFSVIRVNLFVNESVTNAT
LIHELVHRNAETSVTQNIETTDASSPTTDYVKIMVAIVAGTITVILVIFITAVIRCCQSP
HLKAAQKNKQNSEWVTPNPENRQMIMMKKKKKKKKKKHAPKNLLLNFVTIEETKADDADN
DGKSITLDLPIELEEQTMCKYNWGTTPTTFKPDSPDLARHYKSASPQPAFQIQPETPLNS
KHHIIQELPLDNTFVACDSISKCSSSSSDPYSVSEYSYPVTTFKTPVSVHTRLVGIHS
Download sequence
Identical sequences G1NTF5
ENSMLUP00000000449 ENSMLUP00000000449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]