SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000000895 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000000895
Domain Number 1 Region: 281-520
Classification Level Classification E-value
Superfamily VPS9 domain 2.88e-34
Family VPS9 domain 0.0027
Further Details:      
 
Domain Number 2 Region: 49-141
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000356
Family SH2 domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000000895   Gene: ENSMLUG00000000980   Transcript: ENSMLUT00000000979
Sequence length 552
Comment pep:putative scaffold:Myoluc2.0:GL429952:1558448:1564378:-1 gene:ENSMLUG00000000980 transcript:ENSMLUT00000000979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQPEDQALACPTNGERLVPSQENGAGETCLGVLRAPEPLLRLQRTWGVWQIPELDAPAA
EALLELWPPGSFLVTGHEPSQVLVLRTGPSPGEVNTYQIQKLPGGVSLESSHLCMPDLPH
LLAFLSASRDVLPRTLLLPPPTLGSGEQHTDTLQNGSVQLNTSERMISVVNKLYLETHRG
QGMISPPETAPETTKISDPDSAPRNTAPHRVSWVEGPLSPEVHHPGPALASLGEEEDYQE
EGPGDVLTSHVQALARARSSYVARQFRGLQARLTSEAEGPHRPGDPATELLQDVRHLLTD
LQDHLATDPNVRAIFGSRGPGVPQKNEDLGPAVEAALCRAVLAPLMPALWTRLRTLRAPE
LRRLRRQQIALRAGAGPPGAQGAGPEGQGPAPTLRSRIHSRLRHLHAACAPRRKVALLLA
MCRDIYEGLASGEKQEPLGADAFLPALTEELIWSPDIGETQLDVEFLMELLDPEELLGEV
GYYLTTWFGALHHIAHYQPEAGRAPQELSSEASASLCQWHRRRTLQGQGHSRPQADLPFE
EPWEIQTGPRDQ
Download sequence
Identical sequences G1NUJ3
ENSMLUP00000000895 ENSMLUP00000000895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]