SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001137 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001137
Domain Number 1 Region: 154-215
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000268
Family UBA domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001137   Gene: ENSMLUG00000001242   Transcript: ENSMLUT00000001240
Sequence length 215
Comment pep:putative scaffold:Myoluc2.0:GL430087:1063311:1133797:1 gene:ENSMLUG00000001242 transcript:ENSMLUT00000001240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAPVFALFVPFYCSIPRVQVAHILGPLSITNKTLIYILGLQLFTSGSYIWIVAISGLISG
ICYNSKILQVHQVLYIPSWMAKFCSWTLEPIFSSSEPTTEARVGMGATVDIQRQQRMELL
DRQLMLSQFAQARRQRQQQGGMINWNRLFPPLRQRRNINYQEGRRAEQQASPPLEVSEEQ
VARLMEMGFSRGDALEALRASNNDLNVATNFLLQH
Download sequence
Identical sequences G1NV56
ENSMLUP00000001137 ENSMLUP00000001137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]