SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001355 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001355
Domain Number 1 Region: 195-337
Classification Level Classification E-value
Superfamily PH domain-like 1.91e-39
Family Third domain of FERM 0.00043
Further Details:      
 
Domain Number 2 Region: 95-197
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-27
Family Second domain of FERM 0.00014
Further Details:      
 
Domain Number 3 Region: 29-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 2e-17
Family First domain of FERM 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001355   Gene: ENSMLUG00000001477   Transcript: ENSMLUT00000001476
Sequence length 721
Comment pep:putative scaffold:Myoluc2.0:GL429769:7308082:7346660:1 gene:ENSMLUG00000001477 transcript:ENSMLUT00000001476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGVWTGRNYNLKTKLEKENKAWRKNMCGSQKSSGKALFNLSCSHLNLAEKEYFGLEFCSH
SGNNVWLELLKPITKQVKNPKEVVFKFMVKFFPVDPGHLQEELTRYLFTLQIKEDLALGR
LPCSDNCTALMVSHILQSELGDFHEETDRKHLSQTRYLPNQDCLESKIVHFHQKHIGRSP
AESDILLLDIARKLDMYGIRPHPASDGEGMQIHLAVAHMGILVLRGNTKINTFNWAKIRK
LSFKRKHFLIKLHANILVLCKDTLEFTMASRDVCKAFWKTCVEYHAFFRLSEEPKSKPKT
LLCSKGSSFRYSGRTQRQLLEYGGKGRLKSLPFERKHYPSQYHERQCRSSPDLLSDVSKQ
VEDLRLAYGSGYYRNVNGVHASEPVLDSRRRNSAVEVTFAAELERSKPEADPTLLHQSQS
SSSFSFFYTDPVFNTNHDPDTDSTDYFEERSPLSSFRTSCKFADNHMSTSSGLTSKVSPA
KRLTYTDVPYIPCTGQQVDIMPPQVFFYMDKPPQVPRRSPIMVEERESLDSCLEPTAMKP
VKRSPRNIRMKSFQQDFQELKEAMDRTSGRSNFNVDLEDPDLEDAFAYNIQEQPPKRSHS
QSDMKTIRFPFGSEFRPLGPCPALSRKADLFTHMFAEQEFPTVLMDQGASERYVANESSD
SESEILKPDYYSLYGKGTRSPMARIRLSSGSLQLDEEDENVSSNTTAEDRTLLKPCNYFL
A
Download sequence
Identical sequences G1NVP6
ENSMLUP00000001355 ENSMLUP00000001355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]