SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001540 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001540
Domain Number 1 Region: 281-409,719-898
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 8.28e-53
Family Diacylglycerol kinase-like 0.017
Further Details:      
 
Domain Number 2 Region: 6-106
Classification Level Classification E-value
Superfamily PH domain-like 3.15e-22
Family Pleckstrin-homology domain (PH domain) 0.007
Further Details:      
 
Domain Number 3 Region: 187-251
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000143
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00064
Further Details:      
 
Domain Number 4 Region: 119-179
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000733
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001540   Gene: ENSMLUG00000001673   Transcript: ENSMLUT00000001677
Sequence length 956
Comment pep:putative scaffold:Myoluc2.0:GL429963:1647559:1717032:-1 gene:ENSMLUG00000001673 transcript:ENSMLUT00000001677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSQLRRQKILKEGPLLKSCNSFKRWKLRYFLVRGQRLSHVLSTKSMMFAHFETVDLSQVV
LAETSCRNLCHSFCVITPQRKLILAAPNRKDMEEWINVIKTVQQGEIRKEIIPTAENNPY
LIGMHYWYSSHSPRTQHCNVCRESIPALSRNVITCEVCKVKSHRLCALRANKDCKWNTLS
ITDDLLIPADEIETMPHQWVEGNISVSSQCAVCHENCGSNQRLQDFRCLWCNSTVHDDCR
RRFSKECWFGRHRKSIIPPTALSDPKGDDFWNLDWSSACSCPLLIFINSKSGDHQGVIFL
RKFKQYLNPSQVFDLSKGGPEAGLSMFKNFARFRIVVCGGDGSVSWVLSLIDALGLHERC
QLAVIPLGTGNDLARVLGWGAFWNKNKSPLNILNRVEQASVRILDRWSVMIRETPRQTPL
LRGQVDTSNDHRAKIIYEDLQKNSLIMIISREAAELMVKSQKFLCSAVEDFVIDIVKTWS
QIKQNNATIESVILKKYTYICHFNNIIIQHIPKHAHIQRQTHQAPMLNVLIDVLAEEAAV
EKSATVCADSSKAHGKPFVPQIDHIAKCKLELATKAKNLQKSLKLIVFQVEQVVLDEQSR
QMISVKNFTSTFSPEDDSEDISQTSPRHRKDISVLLLLFYPLSLSSSGRKQTLNVISEKV
IELDPTSTENILCLGSRCGILSSIPSLTTFHLFLSPAPTPFYFTIGLSPWTYLMRCFKEK
CVMNNYFGIGLDAKISLEFNTRRDEHPGQYNSRLKNKMWYGLLGSKELLQRSYRNLEERV
HLECDGEAISLPNLQGIVVLNITSYAGGINFWGSSTATTEYEVPAIDDGKLEVVAIFGSV
QMAMSRIINLHHHRIAQCREVMITIDGEEGIPVQVDGEAWVQRPGLIKIRYKNAAQMLTR
DQDFENSMKMWECKHTEIQAASQPQLDSQESQDSLSDEESAQIQHLAQLAENLISR
Download sequence
Identical sequences G1NW57
ENSMLUP00000001540 ENSMLUP00000001540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]