SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001547 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001547
Domain Number 1 Region: 130-408
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.06e-79
Family Nuclear receptor ligand-binding domain 0.00000000133
Further Details:      
 
Domain Number 2 Region: 77-156
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.46e-27
Family Nuclear receptor 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001547   Gene: ENSMLUG00000001683   Transcript: ENSMLUT00000001684
Sequence length 448
Comment pep:putative scaffold:Myoluc2.0:GL429806:5218794:5370506:-1 gene:ENSMLUG00000001683 transcript:ENSMLUT00000001684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTS
SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRD
KNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPTKQECTESYEMTAELDDL
TEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTSLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRR
PNKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSS
SGNTAEHSPSISPSSVENSGVSQSPLVQ
Download sequence
Identical sequences G1NW64
ENSMLUP00000001547 XP_005856656.1.60319 XP_006087669.1.53796 XP_008151860.1.99482 ENSMLUP00000001547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]