SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001571 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001571
Domain Number 1 Region: 268-392
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.72e-37
Family Translational machinery components 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001571   Gene: ENSMLUG00000001715   Transcript: ENSMLUT00000001716
Sequence length 392
Comment pep:putative scaffold:Myoluc2.0:GL429997:1663537:1728971:1 gene:ENSMLUG00000001715 transcript:ENSMLUT00000001716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASCVSCGAVVSQRLLLRPRVSLAPRQVLWKAAELQSVPGPQILRLKHVTVVTTKKNVK
ALRRETYTVDFIKKQIEEFNIGKRHLANMMGEDPETFTQEDIDRAIAYLFPSGLFEKRAR
PIMKHPEQIFPKQKATQWGEDGRPFHYLFYTGKQSYYSLMHDTYGKILDIEKHKNQLQAK
GLFSEKDKTTDLIGSRWLIKEELEEMLVEKLSDQDYAQFLRLMERLLQCGAAEEEFVQSF
RRSVTVQSKKQPIEPVQHDAQGMAFSTSEGRRKSAKAEAVVYEHGNGRIKINGIDYLLYF
PVLQDREQLMFPFHFLDRLGKHDVTCTVSGGGRSAQAGAIRLAMARALCSFVTEEEVEWM
RQAGLLTSDPRVRERKKPGQEGARRKFTWKKR
Download sequence
Identical sequences G1NW81
ENSMLUP00000001571 XP_006098412.1.53796 ENSMLUP00000001571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]