SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000001918 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000001918
Domain Number 1 Region: 654-745
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 4.84e-40
Family Small-conductance potassium channel 0.0000026
Further Details:      
 
Domain Number 2 Region: 523-694
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-26
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000001918   Gene: ENSMLUG00000002106   Transcript: ENSMLUT00000002106
Sequence length 838
Comment pep:putative scaffold:Myoluc2.0:GL429767:12345025:12488521:-1 gene:ENSMLUG00000002106 transcript:ENSMLUT00000002106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPIVLVRPTNRTRRLDSTGAGMGPSSHQQQESPLPTITHCAGCTTAWSPCSFNSPDMETP
LQFQRGFFSEQPPPPRSSHLHCQQQQPSQDKPCPPFASLPHAHHHPHLAHQQPGSGGSSP
CLRCNSCASSGAPGAGAGAGDNLSLLLRTSSPGGAFRTRTSSPLSGSSCCCCSSRRGSQL
NVSELTPSSHASALRQQYAQQPASASLYHQCHSLQPAASPTGSLGSLGSGPPLSHHHHHP
HLAHHQHHQSQARRESNPFTEIAMSSCRYNGGVMRPLSNLSASRRNLHEMDSEAQPLQPP
ASVGGGGGASSPSAVAAAASSSAPEIVVSKPEHNNSNNLALYGTGGGGSTGGGGGSGSGH
GSSSGTKSSKKKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYD
KASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEI
LVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFT
DASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDV
TSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTK
AEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQ
LRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSI
HALPGLISQTIRQQQRDFIEAQMENYDKHVAYNAERSRSSSRRRRSSSTAPPTSSESS
Download sequence
Identical sequences G1NX35
ENSMLUP00000001918 ENSMLUP00000001918 XP_014317552.1.53796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]