SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002668 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002668
Domain Number 1 Region: 207-286
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000006
Family DEATH domain, DD 0.024
Further Details:      
 
Domain Number 2 Region: 30-81
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000432
Family TNF receptor-like 0.0026
Further Details:      
 
Domain Number 3 Region: 86-140
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000145
Family TNF receptor-like 0.013
Further Details:      
 
Domain Number 4 Region: 283-372
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000278
Family DEATH domain, DD 0.064
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000002668
Domain Number - Region: 135-182
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0324
Family TNF receptor-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002668   Gene: ENSMLUG00000002940   Transcript: ENSMLUT00000002936
Sequence length 402
Comment pep:putative scaffold:Myoluc2.0:GL429784:7091720:7100020:-1 gene:ENSMLUG00000002940 transcript:ENSMLUT00000002936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNLPCCAAQQFLDISIKWTTQEIFPPKYLHYDPDTSRQLMCDKCPPGTYLKQHCTARRKT
VCAPCPDNYYTNTWHTSDECLYCNTVCKELQYVKQECNRTHNRVCECEEGRYLELEFCLK
HRSCPPGFGVLQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSAFGLLLTQKGNAT
HDNICSGNSDSTHRCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERI
KRRHSSQEQTFQLLKLWKHQNKDQDMVKKIIQDIDLCENSVQRHLGHTNLTSEQLRSLME
SLPGKKVTTEDIEKTTKACTSSGEQILKLLSLWRVKNGDQDTLKGLMHALKHLKTYHFPK
TVSQSLKKTIRFLHSFTMYRLYQKLFLEMIGNQVQSVKISCL
Download sequence
Identical sequences G1NZ03
ENSMLUP00000002668 ENSMLUP00000002668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]