SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000002731 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000002731
Domain Number 1 Region: 1-171
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.51e-50
Family Protein kinases, catalytic subunit 0.0000471
Further Details:      
 
Domain Number 2 Region: 622-799
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.86e-47
Family Nucleotide and nucleoside kinases 0.0000000469
Further Details:      
 
Domain Number 3 Region: 480-598
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-33
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 4 Region: 347-447
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-21
Family PDZ domain 0.0000162
Further Details:      
 
Domain Number 5 Region: 215-266
Classification Level Classification E-value
Superfamily L27 domain 1.53e-19
Family L27 domain 0.0000947
Further Details:      
 
Domain Number 6 Region: 276-327
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000000647
Family L27 domain 0.0000598
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000002731   Gene: ENSMLUG00000002989   Transcript: ENSMLUT00000003004
Sequence length 803
Comment pep:putative scaffold:Myoluc2.0:GL429843:2177258:2391106:-1 gene:ENSMLUG00000002989 transcript:ENSMLUT00000003004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRVG
TPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQ
WSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNAR
RKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTSSGAVSQVLDSLEEIHALTDCSEKD
LDFLHSVFQDQHLHTLLDLYDKINTKSSPQIRNPPSDAVQRAKEVLEEISCYPENSDAKE
LKRILTQPHFMALLQTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTR
VRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQ
TVEQLQKMLREMRGSITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSDLPST
TQPKGRQIYVRAQFEYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSKNG
TAGLIPSPELQEWRVACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVT
YEEVVKLPAFKRKTLVLLANGLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEE
NGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALK
VLRTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEIDETI
RHLEEAVELVCTAPQWVPVSWVY
Download sequence
Identical sequences G1NZ58
ENSMLUP00000002731 ENSMLUP00000002731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]