SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003081 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003081
Domain Number 1 Region: 83-201
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.98e-17
Family Ubiquitin-related 0.0000267
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003081   Gene: ENSMLUG00000003394   Transcript: ENSMLUT00000003390
Sequence length 211
Comment pep:putative scaffold:Myoluc2.0:GL430313:260734:268609:1 gene:ENSMLUG00000003394 transcript:ENSMLUT00000003390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VALGRNQPLKKEKPKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAHAFES
NDHELAQAIIDGANITLPHGSLTECYDELGNRYQLPVYCLAPPINMIEEKSDIETLDIPE
PPPNSGYECQLRLRLSTGKDLKLVVRSTDTVYHMKRRLHSAEGVEPSSQRWFFSGRPLTD
KMKLEELKIPKDYVVQVIMSQPLQNPTPVEN
Download sequence
Identical sequences G1P015
ENSMLUP00000003081 ENSMLUP00000003081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]