SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003191 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000003191
Domain Number - Region: 46-160
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0345
Family FCH domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003191   Gene: ENSMLUG00000003510   Transcript: ENSMLUT00000003508
Sequence length 201
Comment pep:putative scaffold:Myoluc2.0:GL430650:130510:131112:1 gene:ENSMLUG00000003510 transcript:ENSMLUT00000003508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGPLDEVIRKRLLIDGNDAGDDRRINLLVKSFIKWCNSGSQEEGYNQYQRMLSTLSQCEF
SMGKTLLIYDMNLREMESYEKIYKEIECSIAGAHEKIAECKKQILQAKRIQKNRQEYDAL
AKVIQHHPDRHETLKELEAMGKELEHLSHIKESVEDKLELRLKQFHVLLSTIHELQQTLE
NDEKLSELEEAQETNVDADPK
Download sequence
Identical sequences G1P0B6
ENSMLUP00000003191 ENSMLUP00000003191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]