SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003300 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000003300
Domain Number 1 Region: 145-282
Classification Level Classification E-value
Superfamily Cadherin-like 7.42e-27
Family Cadherin 0.00018
Further Details:      
 
Domain Number 2 Region: 444-560
Classification Level Classification E-value
Superfamily Cadherin-like 7.71e-16
Family Cadherin 0.0016
Further Details:      
 
Domain Number 3 Region: 76-157
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000136
Family Cadherin 0.0012
Further Details:      
 
Domain Number 4 Region: 262-334
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000742
Family Cadherin 0.00086
Further Details:      
 
Domain Number 5 Region: 573-655
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000597
Family Cadherin 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003300   Gene: ENSMLUG00000003622   Transcript: ENSMLUT00000003625
Sequence length 1105
Comment pep:putative scaffold:Myoluc2.0:GL429860:2188945:2224834:-1 gene:ENSMLUG00000003622 transcript:ENSMLUT00000003625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWLLFRNIRLWIIFLVVLEVNSEFIVEVKELDVEKGTTKWQTVRRQKREWIKFAAACRE
GEDNSKRNPIARIRSDCEVSQKITYRISGVGIDRPPYGVFAINPQTGEINITSVVDREIT
PLFLIYCRALNARGEDLERPLELRVKVMDINDNPPVFTQNVYTGSIEENSDANTLVVKLS
ATDADEDNHLNSKIAYKIISQEPAGAPMFILNRYTGEVRTMSSFLDREEHSMYNLLVRGS
DRDGAADGLSSECACRIQVLDVNDNFPTLERTSYSASIEENCLSSELMRLKATDLDEEGT
DNWLAKYLILSGNDGNWFEIQTDPRTNEGILRVVKCPMCRYKLETKLQTNKIQMNIDAIK
HIAGRTVCLDNVCVIPLGFGVWNDVTNDLYSSHPQNAQMLDYEQMPNIHLSIGVKNQAEF
HHSVASRFRMHSTPVRIQVINVREGPTFDPNSMTFSVQEGVRGDSLTNYVLGTYTAVDLD
TGNPATNVRYIIGHDAGSWLKVDSRTGEIQFSREFDKKSKYITNGIYTAEILAVDDGSGK
TATGTICIEVPDVNDYCPVIVAESNAICTASPSILISARDINHHSYGSPFTFCVVDQPPG
TANLWDIKSVNATSALLTAGQPLSAGAYQIPILVKDSFNRACELPQTVKIEACDCDISQT
CLHSSTPGIYTGDGSSVTSDIYGPVPGDRIEGSNVGLGPAGIGMIALGLLLLLLSPLLLL
FCCCKRRQPEGLGTRFAPVPEGGEGVIQSWRIEGAHPEDRDVSNICVPITASNTQDRMDS
SDIYTNTYAAGGTVEGGVSGMELNTGLGTTGLAAGAGGTLRRRGSMLGPPREQADMGLNL
AFLDSYFSEKAYVYADEDEGRPANDCLLIYDHEGVGSPVGSIGCCSWIVDDLDEDYMETL
DPKFRTLAEICLDTEIEPFPSHQACIPISTDLPLLGPNYFVNESSGMTLSEAEFQAEMAM
PEPMIHGDIVVTETYTTTDQCMQPTTIVFDPQLAPNVVVTETVMTPVYDVQGNLCVPAEL
ANAQNVIYTERVVSSPGVPDMRSGSMTDGCMGPVMSGSILVGPEIQVTQMVNPPDIHISR
TIGSTSPMTSRHRVTRYSNIHYSQQ
Download sequence
Identical sequences G1P0L3
ENSMLUP00000003300 ENSMLUP00000003300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]