SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000003457 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000003457
Domain Number - Region: 179-331
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0706
Family FCH domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000003457   Gene: ENSMLUG00000003792   Transcript: ENSMLUT00000003792
Sequence length 356
Comment pep:putative scaffold:Myoluc2.0:GL429827:6282747:6298387:-1 gene:ENSMLUG00000003792 transcript:ENSMLUT00000003792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSVTRSETVEEQVLEEEPVTSKTHDHQMESNPNPVEVCTKSSASLEMTQGVSKERSHVG
CSPKKGECCDLSHEEGLQPRSLHLSPQEQSAHHRDRRQSWRRASMKEINRRKSLPPFHQG
ITELSRSISVDLAESKRLGALLLSSFQFSVQKLEPFLKGTEGFSLESFRAKASSLSEELK
HFADRLESNGTLQKCFEDTKGKASDLSLEASVAEMKEYITKFSLERQTWDQLLLHYQKEA
EEILSRGSTETKMTEVEPTAYLGSSQNEVLNTKPDYQKILQSQNKVFDCMELVMDELQGS
VKQLHAFMDESTQCFQKMSVQLSKRSTQQLDSSPARKLLKLQLQNLPTAHCSKSCQ
Download sequence
Identical sequences G1P0Z4
ENSMLUP00000003457 ENSMLUP00000003457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]