SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004036 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004036
Domain Number 1 Region: 299-483
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.41e-39
Family SPRY domain 0.00021
Further Details:      
 
Domain Number 2 Region: 14-85
Classification Level Classification E-value
Superfamily RING/U-box 3.98e-21
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 3 Region: 95-156
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000412
Family B-box zinc-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004036   Gene: ENSMLUG00000004435   Transcript: ENSMLUT00000004433
Sequence length 493
Comment pep:putative scaffold:Myoluc2.0:GL429768:39375401:39394759:1 gene:ENSMLUG00000004435 transcript:ENSMLUT00000004433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESEPSLSPTLSRSIKEELLCAVCYDPFRDAVTLRCGHNFCRECVTRCWEVQTTPTCPVC
KDRVAPADLRTNHTLNNLVEKLLREDTEGGRYAGHRSPRFCRAHRGQLSLFCIEDKELLC
CSCQADPRHLGHRVQAVKDTAHDFRAKCRNMEHSLREKAKAFWAMRRSYEAIAKHNQVEA
TWLERRIRQEFEKLREFLRGEEQAILDVMAEEARQKQHLVEEKMKQLKKDTETLAHEIER
LQMEMKEDDISFLMKHKSRKRRLFCTMEPEPVQPGMLINVCKYLDSLQYRVWKKMVMSVE
TVPFSFDPNTAAGWLAVSEDLTSVTNHGYRVQVENPERFSSAPCLLGSRSFSHGSHAWEV
DLGGLPSWRVGVVRMCLETGPEGYSHSCYQDTRSGFWYLCRTQGVEGDHCVTSDPATSPL
VPSIPRRLRVELECEEGELSFYDAERQCHLYTFHARFGEVRPYFYLGGTRGNGPPEPLRI
CPLRITVKKELDT
Download sequence
Identical sequences G1P2E7 L5LSG0
XP_006082013.1.53796 XP_006764828.1.95426 ENSMLUP00000004036 ENSMLUP00000004036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]