SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004098 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004098
Domain Number 1 Region: 588-727
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-46
Family Phosphotyrosine-binding domain (PTB) 0.000015
Further Details:      
 
Domain Number 2 Region: 451-573
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-21
Family SH2 domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004098   Gene: ENSMLUG00000004502   Transcript: ENSMLUT00000004503
Sequence length 733
Comment pep:putative scaffold:Myoluc2.0:GL430096:1107080:1124100:-1 gene:ENSMLUG00000004502 transcript:ENSMLUT00000004503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSPLLAGGHAVCLPPCEEPRRVLHPAPSPNLPPPYPYYTTEGWGAQALMASTPCKEPPN
RLQQAPQAGAKASCLLRSPGEQSGALEDLDSYIGFSLESLNQMILELDPTFQLLPTGSGG
PWAEPTQSTTSQRKKEEPEALDIKYIEVTSARSRCHDGPQRCSSPSVTPPFGSPRNGGLL
LSRDVPRETRSSSESLIFSGNQGIGHQRPPPPPGALSSHPPPSPSISIPCTRSKASGPHG
FGSPLMASPGLEKGLGGPATLGGNGVSMVSAHPATDVSYVFGSSQSLLRSSISSPQSSSR
SLESPASSSSSLHSLGPGSLCTRASDNQVPSSTTPSRGQPRVACSPPLDKEHASSCPPSI
ANSMVDIPIVLINGCPEPGSSPPQRTPGPQDFVRPGAAPANNPCPATRSHSQTLPDASPT
ASPHVCFGFLSQTESIPKVPLLCSSPGPARDMQPTMKFVMDTSKYWFKPSITREQAIELL
RKEEPGAFVVRDSSSFRGSFGLALKVQEAPAPAQNRSGEDSSDLIRHFLIESSAKGVHLK
GADEEPYFGSLSAFVCQHSIMPLALPCKLTIPQKEMGGGDGASDPATDSRASCLKRSAGC
HVLYLSSVSVETLTGALAVQKAISAILERDVLPTPTVVHFKVTEQGITLTDVQRKVFFRR
HYPLSTLRFCGMDPEQRKWQKYCKPSWIFGFVAKSQTNSQENVCHLFAEYDTVQPASQVI
SLVGALLQDTERM
Download sequence
Identical sequences G1P2K7
ENSMLUP00000004098 ENSMLUP00000004098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]