SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004885 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004885
Domain Number 1 Region: 71-138
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.45e-21
Family TB module/8-cys domain 0.0005
Further Details:      
 
Domain Number 2 Region: 24-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000016
Family EGF-type module 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004885   Gene: ENSMLUG00000005336   Transcript: ENSMLUT00000005354
Sequence length 146
Comment pep:putative scaffold:Myoluc2.0:GL430188:17342:19031:1 gene:ENSMLUG00000005336 transcript:ENSMLUT00000005354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNSNRVGAPGGPCPAGFERVNGSCEDVDECATGGRCQHGECANTHGGYTCVCPDGFLLDS
SRSSCISQHVISEAKGPCFRVLRDGGCSLPILRNITKQICCCSRVGKAWGRGCQLCPPFG
SEGFREICPAGPGYHYSASDLRYNTR
Download sequence
Identical sequences G1P4J7
ENSMLUP00000004885 ENSMLUP00000004885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]