SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004906 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004906
Domain Number 1 Region: 629-929
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-84
Family Protein kinases, catalytic subunit 0.000000000711
Further Details:      
 
Domain Number 2 Region: 32-204
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.25e-74
Family Ephrin receptor ligand binding domain 0.000000906
Further Details:      
 
Domain Number 3 Region: 334-540
Classification Level Classification E-value
Superfamily Fibronectin type III 2.04e-42
Family Fibronectin type III 0.0000739
Further Details:      
 
Domain Number 4 Region: 923-998
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.59e-22
Family SAM (sterile alpha motif) domain 0.00028
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000004906
Domain Number - Region: 265-311
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0306
Family TNF receptor-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004906   Gene: ENSMLUG00000005373   Transcript: ENSMLUT00000005376
Sequence length 1001
Comment pep:putative scaffold:Myoluc2.0:GL429863:3276652:3445245:-1 gene:ENSMLUG00000005373 transcript:ENSMLUT00000005376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFQTRNPSWIILCYIWLLRFAHTGEAQAVKEVLLLDSKAQQTELEWISSPPNGWEEISG
LDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCK
ETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKK
GFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEE
EAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPYPACGRGFYKSSSQDLQCSRCP
THSFSDKEGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADN
GGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEA
VNGVSDLSRSQRLFAAVSVTTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYE
IKYYEKDQRERTYSTVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEE
ATGKMFEATAVSSEQNPVIIIAVVAVAGTIILVFMVFGFIIGRRHCGYSKADQEGDEELY
FHFKFPGTKTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGK
RDVAVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENG
SLDAFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDF
GLSRVIEDDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPY
WDMSNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERSERPKFEQIVGILDKMIRNP
SSLKTPLGTCIRPISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVAR
MTIEDVMSLGITLVGHQKKIMSSIQTMRAQMLHLHGTGIQV
Download sequence
Identical sequences G1P4L7
ENSMLUP00000004906 ENSMLUP00000004906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]