SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004924 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004924
Domain Number 1 Region: 32-104
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-16
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000004924
Domain Number - Region: 111-140
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000275
Family B-box zinc-binding domain 0.003
Further Details:      
 
Domain Number - Region: 247-288
Classification Level Classification E-value
Superfamily YppE-like 0.0334
Family YppE-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004924   Gene: ENSMLUG00000005394   Transcript: ENSMLUT00000005396
Sequence length 361
Comment pep:putative scaffold:Myoluc2.0:GL431619:24428:30806:1 gene:ENSMLUG00000005394 transcript:ENSMLUT00000005396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKVSPKTSSNTDQGNYIEANDLITQIPSKVQIQDITKELHCLLCNDWFRDPLMLTCGHNF
CQACIQNFWKQRTKETFCPKCKMMCQHANCAFNLVLERLVDKIKDLPLLKGHPQCPEHGE
NLKLFSKPEGKLICFQCKDARLSGGESKEFLQISDAVHFFTEEFIIIKDQLEATLKELQS
LRNRQRDAIAAYKDNKLHLQQHISVEFLKLHQFLHGKEKDILNELRQEGKVLNEEMELNL
NQLQEQYLLVKEMLVSLQARMEEQNSFNFLKDITPFLDSLEKGMKVLTPRELISRNLNLG
LYKGPIQYMMWREMQSIISPGISGITSQPMILIVLSNVTTNILYCFAKSGMPNMNSKFLS
S
Download sequence
Identical sequences G1P4N3
ENSMLUP00000004924 ENSMLUP00000004924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]