SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000004997 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000004997
Domain Number 1 Region: 207-359
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-32
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 97-205
Classification Level Classification E-value
Superfamily Second domain of FERM 6.41e-24
Family Second domain of FERM 0.0012
Further Details:      
 
Domain Number 3 Region: 11-97
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.79e-20
Family First domain of FERM 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000004997   Gene: ENSMLUG00000005465   Transcript: ENSMLUT00000005477
Sequence length 985
Comment pep:putative scaffold:Myoluc2.0:GL429890:1544229:1658562:-1 gene:ENSMLUG00000005465 transcript:ENSMLUT00000005477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSCCLSPQMTEGRHCQVHLLDDRRLELLVQPKLLARELLDLVASHFNLKEKEYFGITFTD
DIGQQNWLQLDHRVLDHDLPKKPGPAILHFAVRFYIESISFLKDRTTVELFFLNAKSCVH
KGQIEVDSETVFRLAALALQEAKGDYTSDENARKDLRTLSAFPTRTLQEHPSLAYCEDRV
IEHYLKTRGLTRGQAVVQYMKIVEALPTYGVHYYAVKDKQGLPWWLGISYKGIGQYDLQD
KVKPRKLFQWKQLENLYFREKKFAVEVHDPRRISVSRRTFGQSGLFVQTWYAHSSLIKSI
WVMAISQHQFYLDRKQSKAKIPSARSLDDIAMDLTEMGTPRTSKLVTLEAKSQFIMASNG
SLISSGSQDSEVSEEQKREKILELKKKEKLLQEKLLKKVEELKKICLREAELTGKMPKEY
PLGIGEKPPQVRRRVGTAFKLDDNLLPSEEDPALQELESNFLIQQKLVEAAKKLANEPDL
CKTVKKKRKQDFTDAVRRLQEIENAINEYRIRCGKKPTQKGTGPLPEDIIPSESSSLSDT
TTCDDPNDTFTLAGQRSSSVPHSPRILPPKSLGIERIHFRKSSIGDQLVDARQPREMLST
HSSPYKTPERRPPGGRSMPTTPVLTRNAYSSSHLEPEPPAQHCRQRSGSLESQSRLLSEL
DHDRPFFSLCKSQRSSSTEVLDDGSSCTSQSSAEYYCVAPAAGPRHGAHTLDARARGRRR
SRKQSAAPSSSGSMPNLAPRDSLRSGVHAQGHEQPSYYIGCTPFAECDLYYGGGYVYEND
TEGQYSVNPSYRSSVHYAYDRQRDYSRSFHEDEVDRVPHNPYATLRLPRRAAGSERVTKH
IHKALVAEHLRGWYQRASGQKEQGHSPQSSVDSDRGSQRCLGWAALQVPCSPGSRASSYS
SVSSANVSGSWRTQMTVGLSEYEAPAHPSYTSCYGNFYSPLPSPGRQYAEAGALDSADGG
RLAGGLEAAEQGLLWHEDSKPGTLV
Download sequence
Identical sequences G1P4U8
ENSMLUP00000004997 ENSMLUP00000004997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]