SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006019 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006019
Domain Number 1 Region: 148-276
Classification Level Classification E-value
Superfamily PH domain-like 7.13e-32
Family Phosphotyrosine-binding domain (PTB) 0.00046
Further Details:      
 
Domain Number 2 Region: 3-131
Classification Level Classification E-value
Superfamily PH domain-like 0.000000135
Family Pleckstrin-homology domain (PH domain) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006019   Gene: ENSMLUG00000006592   Transcript: ENSMLUT00000006593
Sequence length 440
Comment pep:putative scaffold:Myoluc2.0:GL429768:2309598:2313612:-1 gene:ENSMLUG00000006592 transcript:ENSMLUT00000006593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLETPVKDGILYQQHVKFGKKSWRKVWGLLYAGGPSGVARLESWEVRDGGTGPAGDRS
AGPSRRGERRVIRLADCVSVLPADGESCPRDTGAFLLTTTERSHLLAAQHRQEWMGPICQ
LAFPATGEFSSGSGEAEAPKRGLVPMEENSIYSSWQEVGTFPVVVQRTEAATRCQLKGPY
ILLLGQDAIQLSEPGSPQALYTWPYHFLRKFGSDKDVFSFEAGRRCDSGEGLFAFSSPRA
RDLCGVVTAAIARQKERLPELVGPRPCPLPRATSLPSLEPPGELREAPGSEPSDSRRVLL
ADPGPQSLPLLPLESGLYAAVCKRTSGPLAGAEHLYENLCALEAGPVPPDLGDPEQEGPG
GFSPPASPIYHNSKDLGWPGPAHESSLEAQYRRLLELDLDDNGDEAGVSGRSGAHSGFKA
KLVTLLSRERKKGPAPCDRP
Download sequence
Identical sequences G1P7C6
ENSMLUP00000006019 ENSMLUP00000006019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]