SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006128 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006128
Domain Number 1 Region: 265-528
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.07e-79
Family STAT DNA-binding domain 0.0003
Further Details:      
 
Domain Number 2 Region: 529-648
Classification Level Classification E-value
Superfamily SH2 domain 1.24e-35
Family SH2 domain 0.00024
Further Details:      
 
Domain Number 3 Region: 112-273
Classification Level Classification E-value
Superfamily STAT 5.89e-27
Family STAT 0.0035
Further Details:      
 
Domain Number 4 Region: 1-115
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 4.05e-26
Family Transcription factor STAT-4 N-domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006128   Gene: ENSMLUG00000006689   Transcript: ENSMLUT00000006712
Sequence length 846
Comment pep:putative scaffold:Myoluc2.0:GL429886:2527229:2537230:1 gene:ENSMLUG00000006689 transcript:ENSMLUT00000006712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWGLVSQIPPEKLQRLYVDFPQHLRHLLGDWLEKQPWEFLVGSDAFCCNMASTLLSAT
VQHLQASARKQGEGSAILQHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRHLPMS
FHWKQEELKFSTALQRLRHRVGETCLLREALKQEAEAGQVSLHSLIEAPANGTGPSEALA
TLLQETVGELEAAQALVLKRIQIWKRQQQLAGNGAPFDENLTQLQERCESLVDIYSQLQQ
EVGAAGGELEPKTRAALINRLDEVLRTLVTSSFLVEKQPPQVLKTQTKFQAGVRFLLGLR
FLGASAKFPLVRADMVTEKQARELSNPQGPGAGVESSGEITNNTVPFENIGSGNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFTTSFILGPNKLPIQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNQGLLPEHFLFLAQK
IFNDNSLSIETFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLKSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKHEQIGKDGRGYVPATIKMTVERDQPLPTPE
AHMSTMLPTYDLRMAPDPMNMQLSPDMGPQVYPPHSHSIPSYQVLSQEESVNVLPAFPEP
HLQMSPSLDQMSLPFDQSHPQGLLLCQPQEHAMSSPEHLLCSDVTMAEESCRSQPVGGFS
QPTWVGEDMFPPLLPPTEQDLTNLLLEGQGESAGGPLGAQPLLQPNPYGQSGISMSHMDL
RANPSW
Download sequence
Identical sequences G1P7M3
ENSMLUP00000006128 ENSMLUP00000006128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]