SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006140 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006140
Domain Number 1 Region: 217-354
Classification Level Classification E-value
Superfamily Cadherin-like 4.97e-28
Family Cadherin 0.00041
Further Details:      
 
Domain Number 2 Region: 446-575
Classification Level Classification E-value
Superfamily Cadherin-like 5.63e-23
Family Cadherin 0.0011
Further Details:      
 
Domain Number 3 Region: 334-449
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-18
Family Cadherin 0.00025
Further Details:      
 
Domain Number 4 Region: 16-141
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000596
Family Cadherin 0.0039
Further Details:      
 
Domain Number 5 Region: 127-229
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000157
Family Cadherin 0.0015
Further Details:      
 
Domain Number 6 Region: 557-658
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000017
Family Cadherin 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006140   Gene: ENSMLUG00000006714   Transcript: ENSMLUT00000006725
Sequence length 886
Comment pep:putative scaffold:Myoluc2.0:GL429860:2424505:2445607:1 gene:ENSMLUG00000006714 transcript:ENSMLUT00000006725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYMYTLEILICACDACKTVTLHVPSKLDAEKFVGRVNLRECLKSANLIHSSDADFQVLED
GSVYTTNAVLFSSEKRHFTISLSNSENHEEKKMHVLLEHQTKIEALQQSHPKEKVLRRAK
RRWAPIPCSMMENSLGPFPLFLQQIESDAAQNYTVYYSISGPGVDQAPLNLFYVERNTGN
LFCTGPVDREQYPSFEIVAFAATPDGYHPEFPLPLLIRIEDENDNYPIFTNSTYIFTIAE
HSRVGSTVGQVCATDKDEPGTLHTQLKYSILQQLPASPTLFFMNPTTGVITTTTSQLDRE
VLDKYQLKIKVQDMNGQHFGLQTTATCIICIEDVNDHLPTFTRPSYVASVEENTVDVEIL
RVSVEDKDLINTANWRANYTILKGNENGHFKIVTDPKTNEGVLCVVKPLNYEERQQLTLQ
IGVVNEAPYYRETTSRSAMSTATVTVNVKNQDEGPECSPPVQTVRIKENAPVNTKSPGYK
AYNPDTQSSSDIRYKKINDPKGWITVDENTGSITTFRNLDREAESIRNGVYNVTILATDK
VGRTCTGTLGIILEDVNDNGPVILKKTAIICKPTMSSTAIVAFDPDDPVNGPPFQFSLEE
DSDADAQRVWALTKINDTAARLSNQNDLPFGPYTVRVRVTDRHGLSHTTPLNVIMCDCIT
ENDCTFRGVPRTGTGEFRLGKWAILAILLGIALLFCILFTLVCGTAGAAKTPKAFPDDVT
QQNLIVSNTEAPGDDKVYSANGFTTHTVGSAGAGACGTVGSGVIHAGQETIELVKGHQTL
DSCRGGGQHTREPCGAGPVEVDRGRYTYSEWRSFTQPRLGEKVQLCNQDDGHEHAQDYVL
TYSYEGQGSAAGSVGCCSERQEDDRLDFLDHLEPKFRTLAEACVKR
Download sequence
Identical sequences G1P7N3
ENSMLUP00000006140 ENSMLUP00000006140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]