SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006168 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006168
Domain Number 1 Region: 231-366
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-29
Family Cadherin 0.00025
Further Details:      
 
Domain Number 2 Region: 460-584
Classification Level Classification E-value
Superfamily Cadherin-like 2e-21
Family Cadherin 0.0017
Further Details:      
 
Domain Number 3 Region: 348-466
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-18
Family Cadherin 0.00024
Further Details:      
 
Domain Number 4 Region: 31-154
Classification Level Classification E-value
Superfamily Cadherin-like 2.2e-16
Family Cadherin 0.0027
Further Details:      
 
Domain Number 5 Region: 140-242
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000186
Family Cadherin 0.00072
Further Details:      
 
Domain Number 6 Region: 571-667
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000236
Family Cadherin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006168   Gene: ENSMLUG00000006743   Transcript: ENSMLUT00000006756
Sequence length 890
Comment pep:putative scaffold:Myoluc2.0:GL429860:2379734:2400585:1 gene:ENSMLUG00000006743 transcript:ENSMLUT00000006756 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAASAAPGGLFCRQLLFSLLVLILFCDACQKISLQVPSHLQAETLVGKVSVKECLRSAS
LIRSSDPAFRVLEDGSVYTTHDLVLSPPRKSFSIFLSDSQQQEQREMEIVLEARGKKVLR
KRHTKNAALKRSKRRWAPIPCSLMENSLGPFPQHVQQVQSDAAQNYTIFYSISGPGVDKE
PFNLFFINKDTGDIFCTRSIDREQYQEFPLYAYATTADGYAPEYPLPLLFKVEDDNDNAP
YFENKVTIFTVPENCRTGTSVGKVTAIDLDEPDTLHTRLKYKILQQIPDHPKHFSIHPDT
GVITTTSLLLDREKCDTYQLIMEVRDMGGQHFGLFNTGTITISLEDENDNSPYFTENSYF
AEVEENRIDVEILRMKVHDLDLPNTAHSKAVYTILQGNENGNFKISTDPNTNEGVLCVVK
PLNYEAIRQVTLQIGVVNEAQFSKAPNSQPPSMCTTTVTVKVKDSDEGPECQPPVKVIQS
KDGLPAGQELLGYKAVDPETRSGEGLRYKKLGDEDNWFEINENTGDLKTVKVLDRESKFV
KNDQYNVSVVATDAGGRSCTGTLVVLLEDNNDHPPQVDKDVTICQHAQDFAVLSPMDADG
PENGPPFQFLLDNSASKRWTLGSKDGKTAILRAKQHMDYNYYSVPITIKDRHGLAAKHVL
SVRVCDCTTPSDCRMSSQVRDRDAKLPNVVLGKWAILAMVLGSALLLCALFTCFCVVTKR
TAKKCIPDDVAQQNLIVSNTEGPGEEVMEANIRLPTQTSNVCDTSMSVGTLGGQGVKTQQ
SFEMVKGGSGHQTLDSVKGAGQGVMEAGRYTYTDWHSFTQPRLGEKVYLCGQDEEHKHSE
DYVRSYNYEGKGSMAGSVGCCSDRQEEEGLEFLDHLEPKFRTLAKTCIRK
Download sequence
Identical sequences G1P7Q8
ENSMLUP00000006168 XP_006091737.1.53796 ENSMLUP00000006168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]