SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000006287 from Myotis lucifugus 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000006287
Domain Number 1 Region: 257-564
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.19e-88
Family Protein kinases, catalytic subunit 0.0000000199
Further Details:      
 
Domain Number 2 Region: 93-201
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.41e-34
Family Synaptotagmin-like (S variant) 0.00000494
Further Details:      
 
Domain Number 3 Region: 17-73
Classification Level Classification E-value
Superfamily Cysteine-rich domain 9.27e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000006287   Gene: ENSMLUG00000006872   Transcript: ENSMLUT00000006882
Sequence length 595
Comment pep:putative scaffold:Myoluc2.0:GL429789:11526830:11641119:1 gene:ENSMLUG00000006872 transcript:ENSMLUT00000006882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTSGPGSSEGPDRREDPRSKHKFKIHTYSSPTFCDHCGSLLYGLIHQGMKCDTCMMNVHK
RCVMDVSSLCGTGHTERRGRIYIRAHIEGDKRHIRVRDAKNLVPMDPNGLSDPYVKLKLI
PDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSF
GISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGGEGNEELRQKFERAKIGQTPKTPEEKT
TNTIAKFDNNGNRDRMKLSDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQD
DDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEP
HAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTF
CGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYP
KSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPKA
CGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFSFVNSEFLKPEVKSMAI
Download sequence
Identical sequences G1P813
ENSMLUP00000006287 ENSMLUP00000006287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]